Explore our premium grade metabolic regulators, GnRH analogs, and incretin receptor co-agonists manufactured in accordance with strict cGMP protocols and multi-ton synthesis capabilities.
Decoding the central regulator of the Hypothalamic-Pituitary-Gonadal (HPG) axis: Structural classification, receptor pharmacodynamics, and biological significance in translational medicine.
Kisspeptins, encoded by the KISS1 metastasis-suppressor gene located on chromosome 1q32, represent an indispensable family of RF-amide neuropeptides that act as endogenous ligands for the G-protein coupled receptor KISS1R (formerly designated GPR54). Initially isolated as metastin in malignant melanoma cell lines for its capability to block tumor metastasis without suppressing tumorigenicity, the physiological purview of the kisspeptin system was fundamentally transformed with the discovery of its primordial role in mammalian reproduction, neuroendocrine puberty triggering, and gonadotropin-releasing hormone (GnRH) pulse modulation.
Regulatory Mechanism Summary: The full-length prepropeptide comprises 145 amino acids, which undergoes strict enzymatic cleavage by prohormone convertases to yield biologically active fragments: Kisspeptin-54 (KP-54), Kisspeptin-14 (KP-14), Kisspeptin-13 (KP-13), and Kisspeptin-10 (KP-10). All functional isoforms share a conserved C-terminal decapeptide core ending in a signature Arg-Phe-NH₂ motif required for high-affinity receptor binding and activation of downstream Gαq/11-phospholipase C (PLC)-inositol trisphosphate (IP3) signal transduction cascades.
In industrial peptide synthesis, custom kisspeptins present specific synthetic hurdles due to the presence of aggregation-prone sequences, hydrophobic regions, and the requirement for precise C-terminal amidation. The table below delineates the canonical structural parameters of key kisspeptin peptides produced at our China solid-phase synthesis facility:
| Isoform Designator | Residue Count | Primary Amino Acid Sequence (Single Letter) | Monoisotopic Mass (Da) | Receptor Affinity (Ki, nM) | Primary Clinical Target |
|---|---|---|---|---|---|
| Kisspeptin-10 (KP-10) | 10-mer | H-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH₂ | 1301.62 | 0.04 - 0.12 | Hypothalamic Amenorrhea, Male Infertility |
| Kisspeptin-13 (KP-13) | 13-mer | H-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH₂ | 1662.83 | 0.15 - 0.28 | Neuroendocrine Kinetics Research |
| Kisspeptin-14 (KP-14) | 14-mer | H-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH₂ | 1777.86 | 0.20 - 0.35 | Receptor Internalization Profiling |
| Kisspeptin-54 (Metastin) | 54-mer | GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH₂ | 5857.94 | 0.02 - 0.08 | IVF Oocyte Maturation, Anti-Metastatic Oncology |
From assisted reproductive technology (ART) breakthroughs to anti-metastatic drug discovery: The evolving procurement landscape for therapeutic-grade kisspeptin APIs.
Traditional ovulation induction relies heavily on human chorionic gonadotropin (hCG), which exerts prolonged luteotrophic stimulation and carries significant risk of Ovarian Hyperstimulation Syndrome (OHSS). Kisspeptin-54 induces an endogenous luteinizing hormone (LH) and follicle-stimulating hormone (FSH) surge that mimics natural physiology.
Loss of KISS1 expression correlates with invasive phenotypes in clear cell renal cell carcinoma, breast cancer, cutaneous melanoma, and bladder carcinoma. KISS1R activation suppresses cell motility, invasion, and metastatic colonization without inducing systemic cytotoxic side effects common to chemotherapies.
Commercial livestock production, particularly bovine and equine breeding programs, increasingly deploys short kisspeptin decapeptides to overcome seasonal anestrus and synchronize ovulation cycles for artificial insemination (AI) without relying on steroidal hormones or progestins.
How Hangzhou Thinheal Pharma-Tech leverages end-to-end supply chain integration, automated peptide synthesizers, and massive purification infrastructure to slash lead times and production costs.
Unlike Western contract manufacturing organizations (CMOs) that import protected Fmoc-amino acids, coupling reagents (HATU, HCTU, DIC/Oxyma), and polymer resins from Asian exporters, our Hangzhou facility is situated at the epicenter of fine chemical manufacturing. We maintain fully vetted, in-house synthesized high-purity protected amino acids, reducing raw material procurement cycles from months to hours while locking in baseline cost efficiency.
Synthetic peptides of 10 to 54 residues require rigorous chromatographic isolation to separate truncated deletion sequences, epimers (D-amino acid diastereomers), and oxidized tryptophan/methionine side-products. Our Hangzhou site features industrial high-pressure preparative chromatography columns (ID 300 mm to 600 mm) coupled with automated DAC (Dynamic Axial Compression) technology, allowing single-batch runs of up to 10 kg with exceptional purity recovery.
Tiered cost structures engineered for discovery research, preclinical toxicology, and commercial cGMP scale-up. Precise specifications determined by analytical requirements.
| Peptide Variant | Purity Grade | Batch Scale | Typical Lead Time | Indicative Price Range (USD/g) | Analytical Release Package |
|---|---|---|---|---|---|
| Kisspeptin-10 (KP-10) CAS: 374675-21-5 |
≥95% Research | 1 g – 100 g | 10 – 14 Days | $22 – $45 / g | CoA, RP-HPLC, ESI-MS |
| Kisspeptin-10 (KP-10) CAS: 374675-21-5 |
≥98% Preclinical | 100 g – 1,000 g | 2 – 3 Weeks | $14 – $28 / g | CoA, HPLC, HRMS, Residual TFA, Water (KF) |
| Kisspeptin-10 (KP-10) Acetate Salt Grade |
≥99% API Grade | 1 kg – 50 kg | 4 – 6 Weeks | Custom Bulk Quote | Full CTD/DMF, ICP-MS, Bioburden, Endotoxin |
| Kisspeptin-54 (KP-54) CAS: 416592-87-7 |
≥95% High Purity | 1 g – 50 g | 3 – 4 Weeks | $280 – $480 / g | RP-HPLC, MALDI-TOF/MS, Amino Acid Analysis |
| Kisspeptin-54 (KP-54) CAS: 416592-87-7 |
≥98% Clinical API | 100 g – 5 kg | 6 – 8 Weeks | Contract CDMO Tier | Validation Protocols, Stability (ICH Q1A), DMF |
| Modified Kisspeptin Analogs (TAK-448, TAK-683, FTM080) |
≥98% Custom | Custom Orders | 3 – 5 Weeks | Based on Complexity | Peptide Mapping, NMR, Chiral Purity Report |
Our Contract Development and Manufacturing Organization (CDMO) service is structured into five deterministic phases designed to de-risk technology transfer and speed up regulatory filings:
Evaluation of Fmoc vs Boc strategies, selection of sterically unhindered coupling agents, and molecular modeling to bypass beta-sheet aggregation.
Design of Experiments (DoE) focused on cleavage cocktail balance (TFA/TIS/EDT/H₂O) to protect fragile Trp and Arg residues against alkylation.
Pilot verification at 500g – 5kg synthesis scale with continuous chromatographic peak monitoring and salt exchange optimization (TFA to Acetate).
Provision of raw materials trace files, method validation parameters (ICH Q2(R1)), impurities identification, and stability documentation.
Ensuring lot-to-lot bio-equivalence and structural integrity across every gram synthesized at our Hangzhou facility.
Analytical high-performance liquid chromatography (RP-HPLC) using dual-wavelength UV-Vis detection and orthogonal stationary phases (C18, Phenyl-Hexyl). We identify, track, and document deletion peptides, insertion sequences, and enantiomeric D-amino acid impurities down to <0.05% threshold.
Every commercial batch is subjected to electrospray ionization high-resolution mass spectrometry (ESI-HRMS) or matrix-assisted laser desorption/ionization time-of-flight (MALDI-TOF). Molecular weight match is guaranteed within a 0.5 Da variance, confirming exact amino acid sequence fidelity.
Net peptide content is rigorously verified via elemental combustion analysis (CHN) and quantitative Amino Acid Analysis (AAA). Counter-ion conversions (TFA to Acetate or Hydrochloride) achieve <0.5% residual TFA content. Karl Fischer titration maintains water content below 5.0% for stable lyophilization.
Access our validated stock of therapeutic peptides, cardiovascular regulators, dual incretin agonists, and cosmetic signal sequences manufactured under rigorous quality systems.
The transition from manual small-molecule sourcing to automated, sustainable peptide manufacturing: How international pharmaceutical procurement teams select strategic partners.
For large-volume Kisspeptin-10 derivatives, pure Solid-Phase Peptide Synthesis (SPPS) yields excessive chemical solvent waste. Modern industry trends favor LPPS segment condensation, combining short pre-formed fragments (e.g., 5-mer + 5-mer) in solution. This delivers higher atom economy, superior overall yield, and significantly reduced solvent volume per kilogram produced.
Global regulatory bodies like the European Chemicals Agency (ECHA) are phasing out traditional peptide solvents such as Dimethylformamide (DMF) and N-Methyl-2-pyrrolidone (NMP) under REACH Annex XIV. Thinheal leads the transition by adopting greener solvents, including 2-Methyltetrahydrofuran (2-MeTHF) and Cyrene, safeguarding future global compliance.
Tier-1 biopharma sponsors require far more than basic batch certificates. We provide complete Chemistry, Manufacturing, and Controls (CMC) technical files, validation documentation for critical process parameters (CPPs), analytical method validation (ICH Q2), and real-time ICH stability protocols.
Comprehensive scientific, regulatory, logistical, and commercial inquiries answered by our senior peptide chemical engineers and procurement directors.
While both isoforms activate the GPR54 (KISS1R) receptor with sub-nanomolar affinity via their identical C-terminal RF-amide domain, their pharmacokinetic and in vivo half-life profiles differ dramatically. Kisspeptin-10 (a 10-amino acid sequence) exhibits rapid systemic clearance with a biological plasma half-life of approximately 4 to 10 minutes following intravenous injection, making it ideal for acute diagnostic testing, pulsatile GnRH challenge models, and short-term receptor dynamic studies.
In contrast, Kisspeptin-54 (a 54-amino acid polypeptide) demonstrates a substantially extended terminal elimination half-life (~28 to 35 minutes) due to its larger hydrodynamic volume and secondary structural protection. This prolonged systemic presence makes Kisspeptin-54 the clinical candidate of choice for inducing sustained LH/FSH surges during IVF oocyte trigger protocols, providing the required exposure time without causing receptor down-regulation.
Peptides manufactured via standard solid-phase peptide synthesis (SPPS) utilize Trifluoroacetic Acid (TFA) during the resin cleavage and side-chain deprotection stages, resulting in residual TFA salts bound to basic residues (such as Arginine, Lysine, and the free N-terminus). TFA exhibits direct cytotoxicity in primary cell cultures, impairs embryogenesis in reproductive bioassays, and is strictly restricted by regulatory authorities for clinical formulations.
Thinheal uses validated preparative ion-exchange chromatography and diafiltration systems to replace TFA with biocompatible Acetate (AcOH) or Hydrochloride (HCl) counter-ions. Our clinical-grade kiss peptides achieve residual TFA levels below 0.5% (frequently non-detectable via 19F-NMR and ion chromatography), guaranteeing non-toxic physiological compatibility for animal and human models.
Kisspeptin-54 contains multiple hydrophobic residues, consecutive proline residues, and steric hindrance zones that promote inter-chain beta-sheet aggregation during solid-phase chain assembly, resulting in incomplete couplings and chain termination (deletion peptides like [des-Gly] or [des-Leu] impurities).
Our engineering team solves this through pseudoproline dipeptide insertion, microwave-assisted automated continuous flow synthesis, and optimized Oxyma/DIC coupling cocktails at elevated temperatures (50°C). Furthermore, we implement high-dilution TFA/triisopropylsilane cleavage conditions to suppress tryptophan oxidation and alkylation by released t-butyl carbocations.
Prospective biopharma sponsors, academic laboratories, and procurement managers can submit an official Request for Quote (RFQ) through our secure communication portals. Please specify your target peptide sequence (or canonical variant like KP-10, KP-13, KP-54), target mass (grams to multi-kilograms), purity threshold (≥95%, ≥98%, ≥99%), counter-ion preference (TFA, Acetate, HCl), and any specialized analytical requirements (e.g., endotoxin limits, peptide content, specific impurity characterization).
Our dedicated sales desks (North America, Europe, Asia, Russia/CIS) respond within 24 business hours with an all-inclusive quotation, process validation timeframe, and batch delivery schedule.
Lyophilized peptides are inherently hygroscopic and sensitive to thermal cycling. Every kiss peptide batch is packed in pharmaceutical-grade borosilicate Type I vials or aluminum foil vacuum-sealed containers under a sterile nitrogen atmosphere.
International shipments are dispatched via express air freight (FedEx/DHL/Specialized Pharma Forwarders) using calibrated thermal insulated shippers packed with dry ice or phase-change materials (-20°C or -80°C validated). Real-time Bluetooth/cellular temperature logging tags are included to ensure cold-chain integrity from our Hangzhou plant to the client's receiving facility.
Yes. Thinheal provides complete regulatory dossier support conforming to ICH Common Technical Document (CTD) Module 3 requirements (Quality). Our documentation package includes raw materials specifications, synthetic route validation, impurity justification and origin studies, analytical method validations (accuracy, precision, linearity, LOD/LOQ according to ICH Q2), forced degradation stress testing, and 6-to-36-month real-time stability protocols (ICH Q1A).
Thin